2.98 Rating by CuteStat

jaxmark.com is 8 years 3 months old. It is a domain having com extension. This website is estimated worth of $ 8.95 and have a daily income of around $ 0.15. As no active threats were reported recently by users, jaxmark.com is SAFE to browse.

PageSpeed Score
79
Siteadvisor Rating
Not Applicable

Traffic Report

Daily Unique Visitors: Not Applicable
Daily Pageviews: Not Applicable

Estimated Valuation

Income Per Day: $ 0.15
Estimated Worth: $ 8.95

Search Engine Indexes

Google Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: Not Applicable
Bing Backlinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: Not Applicable
WOT Trustworthiness: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Alexa Rank: Not Applicable
Domain Authority: Not Applicable

Web Server Information

Hosted IP Address:

37.60.244.250

Hosted Country:

United States of America US

Location Latitude:

41.8797

Location Longitude:

-87.6435
JAXMARK – Online Marketing Services

Page Resources Breakdown

Homepage Links Analysis

Website Inpage Analysis

H1 Headings: 4 H2 Headings: 2
H3 Headings: 9 H4 Headings: Not Applicable
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: 1 Total Images: 9
Google Adsense: Not Applicable Google Analytics: Not Applicable

Websites Hosted on Same IP (i.e. 37.60.244.250)

Steve Sasco designer of jewelry inspired by celebrities

- stevesascodesigns.com

Steve Sasco – Celebrity Jewelry Designer – Limited Editions. Unique jewelry items inspired by the celebrities who wear them!

Not Applicable $ 8.95

My Blog - My WordPress Blog

- beantoseattle.com
Not Applicable $ 8.95

EDssentials | Inspiration is Essential for EDucation

- edssentials.com
Not Applicable $ 8.95

SiteGround System Page Coming Soon

- ajmlandscaping.com
Not Applicable $ 8.95

SiteGround System Page Coming Soon

- bryanwilksharvardmasterdegree.com
Not Applicable $ 8.95

HTTP Header Analysis

HTTP/1.1 200 OK
Server: nginx
Date: Wed, 07 Jun 2017 05:05:21 GMT
Content-Type: text/html; charset=UTF-8
Transfer-Encoding: chunked
Connection: keep-alive
X-Cache-Enabled: True
Link: <https://jaxmark.com/wp-json/>; rel="https://api.w.org/", <https://jaxmark.com/>; rel=shortlink
Host-Header: 192fc2e7e50945beb8231a492d6a8024
X-Proxy-Cache: MISS

Domain Information

Domain Registrar: Annulet LLC
Registration Date: Feb 9, 2016, 12:00 AM 8 years 3 months 5 days ago
Last Modified: Oct 7, 2016, 12:00 AM 7 years 7 months 1 week ago
Expiration Date: Feb 9, 2018, 12:00 AM 6 years 3 months 2 days ago
Domain Status:
clientTransferProhibited

DNS Record Analysis

Host Type TTL Extra
jaxmark.com A 3599 IP: 37.60.244.250
jaxmark.com NS 21599 Target: ns-cloud-a1.googledomains.com
jaxmark.com NS 21599 Target: ns-cloud-a2.googledomains.com
jaxmark.com NS 21599 Target: ns-cloud-a3.googledomains.com
jaxmark.com NS 21599 Target: ns-cloud-a4.googledomains.com
jaxmark.com SOA 21599 MNAME: ns-cloud-a1.googledomains.com
RNAME: cloud-dns-hostmaster.google.com
Serial: 4
Refresh: 21600
Retry: 3600
Expire: 259200
Minimum TTL: 300